PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017533.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 252aa    MW: 28355.7 Da    PI: 4.7561
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017533.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l      +G  +W+++++  g++R++k+c++rw +yl
      Pbr017533.1 14 KGPWTAEEDKKLMTFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.71.8e-1573111747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E+++ +d++++lG++ W++Ia+ ++ gRt++++k++w+++
      Pbr017533.1  73 AEEQIVIDLHARLGNR-WSKIAASLP-GRTDNEIKNHWNTH 111
                      69**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-21562IPR009057Homeodomain-like
PROSITE profilePS5129413.924961IPR017930Myb domain
SuperFamilySSF466893.19E-2611108IPR009057Homeodomain-like
SMARTSM007173.8E-121363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
CDDcd001674.79E-91661No hitNo description
PROSITE profilePS5129425.61162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-2463117IPR009057Homeodomain-like
SMARTSM007172.3E-1366114IPR001005SANT/Myb domain
PfamPF002492.0E-1373111IPR001005SANT/Myb domain
CDDcd001671.75E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLMTFLL THGQCCWRAV PKLAGLRRCG KSCRLRWINY  60
LRPDLKRGLL NDAEEQIVID LHARLGNRWS KIAASLPGRT DNEIKNHWNT HIKKKLVKMG  120
IDPITHEPLH KQVTTPQEMP REASNQPANS DMNIQQINTN IPEHGICTNS DGNSASENSP  180
SDDSEPAEPN PNCSEEDDPL VSFILSDTFL EDLTWDFSTS SEYSSADNPT EENSLAWFMD  240
CNDFGVEDFE L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3702300.0AB370230.1 Malus x domestica MdMYBB mRNA for myb-related transcription factor, complete cds.
GenBankDQ0744670.0DQ074467.1 Malus x domestica MYB19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374509.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-93ODO1_PETHY; Protein ODORANT1
TrEMBLQ2LME51e-180Q2LME5_MALDO; MYB19
STRINGVIT_16s0022g01210.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.11e-87myb domain protein 42